DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG16713

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:61 Identity:24/61 - (39%)
Similarity:30/61 - (49%) Gaps:11/61 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   136 NAVTG-----------PCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFR 185
            ||:.|           .|.|..|.|.:|.:||.|..||||||.||.|.:.|.|.|..:|.:
  Fly    22 NAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCLQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665 23/57 (40%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.