DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG16704

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster


Alignment Length:66 Identity:23/66 - (34%)
Similarity:28/66 - (42%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    38 CLVSK---------------VVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKK 87
            |||:.               |.|.||:..|.|.|......|..|.|.||.||:|.:..|.||.:|
  Fly    12 CLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEK 76

Human    88 C 88
            |
  Fly    77 C 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 21/64 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/44 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.