DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and Acp24A4

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:47 Identity:25/47 - (53%)
Similarity:33/47 - (70%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   137 AVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRC 183
            |..|.|.|.|.||.:|.:.|.|.|||||||:||:||:.|:|.|:.:|
  Fly    30 AANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665 24/45 (53%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 24/45 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.