DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG31609

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:94 Identity:26/94 - (27%)
Similarity:40/94 - (42%) Gaps:23/94 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    45 GRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSS 109
            |.|...:..|.|:.....|..|.||||.||.|.:.|||||||.|.....                
  Fly    38 GPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC
RVYRP---------------- 86

Human   110 VPSAPRRQDS------EDHSSDMFNYEEY 132
             |:..:|:::      |:...|:.|::::
  Fly    87 -PNRKKREENLDEEEEEEFEEDIDNWDKW 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 20/42 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122 3/27 (11%)
Kunitz_HAI2_2-like 131..183 CDD:438665 0/2 (0%)
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 20/42 (48%)

Return to query results.
Submit another query.