DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and Y55F3BR.2

DIOPT Version :9

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001294458.1 Gene:Y55F3BR.2 / 190314 WormBaseID:WBGene00021939 Length:1549 Species:Caenorhabditis elegans


Alignment Length:165 Identity:47/165 - (28%)
Similarity:74/165 - (44%) Gaps:19/165 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    53 RWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATV-----TENATGDLATSRNAADSSVPS 112
            |::||.|||.|..|.:.|..||.||:..:.:|...||.:     :....|:.:..|.|.|:..||
 Worm   461 RYYYNPTDGQCHPFTFNGFLGNFNNFQNQADCQLFC
ARLQCPHGSPLTNGNGSPQRCARDTDCPS 525

Human   113 APRRQDSEDHSSDMFNY------EEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKN 171
            .        |:..|.:.      :..||.....|.|:.|..:::::.|..:|.:|:|.||:||.|
 Worm   526 T--------HTCAMEHQVCCPTPQTLCTEPLRVGDCKQSVRQFWYNAETKTCESFLYTGCQGNNN 582

Human   172 SYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFV 206
            .:.|...|...|......|..|.|...|..:|.|:
 Worm   583 RFNSLNECQSYCKNINAEPKCPQGRAYVDFSGKFM 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_BPTI 37..88 CDD:394972 14/34 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122 5/21 (24%)
Kunitz_BPTI 132..183 CDD:394972 16/50 (32%)
Y55F3BR.2NP_001294458.1 EB 137..183 CDD:279949
KU <324..365 CDD:197529
KU <459..496 CDD:197529 14/34 (41%)
Kunitz_BPTI 544..595 CDD:278443 16/50 (32%)
KU 649..703 CDD:197529
KU 756..813 CDD:294074
EB 1190..1241 CDD:279949
EB 1246..1297 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161450445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.