DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG42828

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster


Alignment Length:79 Identity:29/79 - (36%)
Similarity:44/79 - (55%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    13 FLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNN 77
            ||.|| ::|||.|.:|::.::   ||.:....|:|......|.::..:..|..||:..|.||.|.
  Fly     7 FLCLL-AVLLSTVESAEKRKA---FCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGNENR 67

Human    78 YLTKEECLKKCATV 91
            :.|||.|.|.|||:
  Fly    68 FYTKENCEKACATI 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 17/51 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
CG42828NP_001189271.1 KU 27..78 CDD:197529 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.