DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG42713

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster


Alignment Length:86 Identity:30/86 - (34%)
Similarity:40/86 - (46%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    13 FLALLGSLLLSGVLAADRE---RSIHDFCLVSKVVGRCRA-------SMPRWWYNVTDGSCQLFV 67
            ||.:|.|::|...|::.:.   |..|..||..|..|..||       :...|:||..:..|....
  Fly     3 FLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIKMR 67

Human    68 YGGCDGNSNNYLTKEECLKKC 88
            |.||.||.|.|.|..||.:||
  Fly    68 YLGCKGNRNRYCTLNECQRKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 20/58 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.