DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG42716

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster


Alignment Length:71 Identity:20/71 - (28%)
Similarity:26/71 - (36%) Gaps:28/71 - (39%)


- Green bases have known domain annotations that are detailed below.


Human    46 RCRASM----PR------------------------WWYNVTDGSCQLFVYGGCDGNSNNYLTKE 82
            ||||.|    ||                        |:||.....|:...|.||.||||.:.:.:
  Fly    22 RCRARMNSGGPRSCSGSRNIGTAFGLGCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQ 86

Human    83 ECLKKC 88
            :|...|
  Fly    87 DCRFTC 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 19/69 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 12/33 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.