powered by:
Protein Alignment SPINT2 and CG42716
DIOPT Version :10
| Sequence 1: | NP_066925.1 |
Gene: | SPINT2 / 10653 |
HGNCID: | 11247 |
Length: | 252 |
Species: | Homo sapiens |
| Sequence 2: | NP_001189116.1 |
Gene: | CG42716 / 10178784 |
FlyBaseID: | FBgn0261633 |
Length: | 97 |
Species: | Drosophila melanogaster |
| Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
| Similarity: | 26/71 - (36%) |
Gaps: | 28/71 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Human 46 RCRASM----PR------------------------WWYNVTDGSCQLFVYGGCDGNSNNYLTKE 82
||||.| || |:||.....|:...|.||.||||.:.:.:
Fly 22 RCRARMNSGGPRSCSGSRNIGTAFGLGCAMNFMPLVWYYNDKSRRCETMPYLGCGGNSNRFCSLQ 86
Human 83 ECLKKC 88
:|...|
Fly 87 DCRFTC 92
|
Known Domains:
Indicated by green bases in alignment.
Return to query results.
Submit another query.