DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LEFTY1 and scw

DIOPT Version :9

Sequence 1:NP_066277.1 Gene:LEFTY1 / 10637 HGNCID:6552 Length:366 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:296 Identity:65/296 - (21%)
Similarity:104/296 - (35%) Gaps:85/296 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   107 LPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRV---RDDGSNRTSLIDSRLV 168
            :|.:..||||:||::::|            |....||..||...|.   |.|.|.|  ::.|...
  Fly   140 VPVDLSLVQAMLRIYKQP------------SLVDRRANFTVSVYRKLDNRQDFSYR--ILGSVNT 190

Human   169 SVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEP 233
            :..:.||..|::|:.:.:|          |....:||.:...::.|..:|..||     |||..|
  Fly   191 TSSQRGWLEFNLTDTLRYW----------LHNKGLQRRNELRISIGDSQLSTFA-----AGLVTP 240

Human   234 QLELHTL------------------------DLGDYGAQGDCDPEAP------MTEGTRCCRQEM 268
            |....:|                        ||....|.|...|..|      ......|.|...
  Fly   241 QASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNF 305

Human   269 YIDLQGMKWAENWVLEPPGFLAYECVGTCRQP-------------PEALAFKWPFLGPRQCIASE 320
            .:|.:.:. ..|||:.|..|.||.|.|.|..|             ...:..|.|.|....|:.:.
  Fly   306 TVDFKELH-MHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTV 369

Human   321 TDSLPMIVSIKEGGRTRPQVVSLPNMR---VQKCSC 353
            ..::.::..:.|      .::.|...:   .::|.|
  Fly   370 LGAITILRYLNE------DIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LEFTY1NP_066277.1 TGFb_propeptide <106..214 CDD:307025 27/109 (25%)
TGF_beta 263..353 CDD:306518 21/105 (20%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 37/142 (26%)
TGFB 300..400 CDD:214556 22/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.