DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RASL10A and RSR1

DIOPT Version :9

Sequence 1:XP_011528123.1 Gene:RASL10A / 10633 HGNCID:16954 Length:223 Species:Homo sapiens
Sequence 2:NP_011668.3 Gene:RSR1 / 853056 SGDID:S000003384 Length:272 Species:Saccharomyces cerevisiae


Alignment Length:122 Identity:30/122 - (24%)
Similarity:54/122 - (44%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    82 LERVRGAGHAEEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILV 146
            ||.:..||.|  ::...::..::....|:|||.:....|.:.:..||:::  .|...:...|:::
Yeast    53 LEILDTAGIA--QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQV--LRIKDSDRVPMVL 113

Human   147 VGNKRDRQRLRFGPRRALAALVRRG------W-RCGYLECSAKYNWHVLRLFRELLR 196
            :|||.|....|       ...|..|      | |..:.|.||....:|..:|.:|:|
Yeast   114 IGNKADLINER-------VISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RASL10AXP_011528123.1 P-loop_NTPase <86..223 CDD:304359 28/118 (24%)
RSR1NP_011668.3 RSR1 3..166 CDD:133377 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.