DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM16 and tn

DIOPT Version :10

Sequence 1:NP_006461.3 Gene:TRIM16 / 10626 HGNCID:17241 Length:564 Species:Homo sapiens
Sequence 2:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster


Alignment Length:269 Identity:51/269 - (18%)
Similarity:100/269 - (37%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    77 CDFCLDDTRRVK--------AVKSCLTCMVNY------CEEHLQPHQV----------NIKLQSH 117
            |..|||..|..|        .::.|:..:|:|      |.|....|::          |:.||..
  Fly    10 CCVCLDRYRIPKLLPCQHSFCMEPCMEGLVDYVRRQVKCPECRAEHRIPYNGVQAFPTNVTLQRF 74

Human   118 L---------LTEPVKDHNWRYC-PAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDK 172
            |         |.:|........| ........:.|...::.||:||...|       :|..||  
  Fly    75 LELHIEITGELPDPTSGQIMERCGVCSEKAYLSHCAHCEKKICEDCKSAH-------MDILRR-- 130

Human   173 EAELQCTQLDLERKLKLNENAISRLQANQKSV---LVSVSEVKAVAEMQFGELLAAVRKAQANVM 234
              |:......:.|.|...:::::.::.|..|:   .:||:|       :..|:...:.||     
  Fly   131 --EITRFNSQIRRSLHRLQDSLAIIEKNTMSLQTNAISVTE-------EIDEIYQRITKA----- 181

Human   235 LFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMAAISNTVQFLEEY---------CKFKN 290
              ::::......:.:...| :|.|:....|...:|| :..|::....:::|         |:..:
  Fly   182 --IKDRSDQLKGEIDRYLA-VELRNLTTLKENLDLE-ITNITSNCDTVDKYMNETVEWDDCELMD 242

Human   291 TEDITFPSV 299
            |::|...:|
  Fly   243 TKEIFLKTV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM16NP_006461.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
Bbox1_TRIM16 75..122 CDD:380897 17/77 (22%)
Bbox_SF 129..173 CDD:469587 10/44 (23%)
CusB_dom_1 <164..>283 CDD:481212 21/121 (17%)
SPRY_PRY_TRIM16 365..546 CDD:293948
tnNP_001137707.1 RING-HC_NHL-1-like 3..55 CDD:438187 11/44 (25%)
CC_brat-like 124..232 CDD:475168 23/134 (17%)
NHL_TRIM71_like 1234..1517 CDD:271324
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.