DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CENPE and Kif3C

DIOPT Version :9

Sequence 1:NP_001804.2 Gene:CENPE / 1062 HGNCID:1856 Length:2701 Species:Homo sapiens
Sequence 2:NP_651939.4 Gene:Kif3C / 43820 FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster


Alignment Length:643 Identity:200/643 - (31%)
Similarity:299/643 - (46%) Gaps:142/643 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAEEGAVAVCVRVRPLNSREE--------SLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNE 57
            |:|.  :.|.||.||:|..|:        .:.|.|    .:..|...::...|.|.||.|::...
  Fly     1 MSEN--IKVVVRCRPMNQTEKERNCQNIVEINEFA----VSVTNPSARISQQKKFIFDSVYNMKT 59

Human    58 TTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSE---DHLGVIPRAIHDIFQKIKK 119
            .|:.:|:|:...:::|.|:||||||||||||..|||:||.|.|   :..|:||:....||::|..
  Fly    60 DTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDENFSNSTGIIPKCFDHIFERISM 124

Human   120 FPDREFLLRVSYMEIYNETITDLLCGTQKMKPL--IIREDVNRNVYVADLTEEVVYTSEMALKWI 182
            ..:..:|..|:|:|||||.|.|||...:....:  .::|.....|.|..||.:.|..:.....|:
  Fly   125 TTNVRYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWL 189

Human   183 TKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEP------SNCEGSVKVSHLNLVDLAGSER 241
            ..|.|:|....|.||:.||||||||.:.||.    .|      |:..|.:....|:|||||||||
  Fly   190 HFGNKNRVTAATLMNKNSSRSHTIFTITLEQ----SPFLNSIGSDAFGGICRGKLSLVDLAGSER 250

Human   242 AAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIIC 306
            ..:|||.|.||||...||.||..||.||..|.||: ...:.:|||||||:||:|||||.||.:|.
  Fly   251 QRKTGAQGDRLKEASQINLSLSALGNVISSLVDGK-AKHVPFRDSKLTRLLQDSLGGNTKTLMIS 314

Human   307 TITP--VSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLEE-------- 361
            .|:|  :.:|||::.|::||.||.:.|.|.:||...| |.|::|:.||:.||:.|:|        
  Fly   315 CISPTDIHYDETISTLRYASRAKNISNKPKINEDPKD-ARLRQYQNEILYLKRMLQESQQIINKN 378

Human   362 -----------------------------------VSLETRAQAMEKDQLAQLLEEKDLLQKVQN 391
                                               .|.:|....:.|... .|::.|:.:|....
  Fly   379 NDPNKIIKSPLKIIQHTNMNSTKNVQIIDLGRNCKASFKTNNSILTKPNF-PLIQSKEEVQLQAR 442

Human   392 EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSIN 456
            .:|:.:.|.|:....:. ..|||.|...|              .||.|.::..        ::|.
  Fly   443 SRIDLIKRSLIGGERIH-DFELKEKHMAR--------------KYAAQRHLSA--------IAIA 484

Human   457 LLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDNLVLDYEQLRTEK 521
            |.|    ..|.:.|:......|:::                 |:: ::.||         :|..|
  Fly   485 LSR----VKCEDRDLLQGHYATITQ-----------------EID-IKNDY---------IRKCK 518

Human   522 EEMELKLKEKNDLDEFEALERKTKKDQEMQLIHEISNLKNLVKHAEVYNQDLENELSS 579
            |::::...|.:||:....|:|:...|       ||.||...||    ::|.|..:.||
  Fly   519 EKIKMLEMEVSDLNSEFQLDREDYLD-------EIRNLGRQVK----FHQQLFLKFSS 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CENPENP_001804.2 KISc 6..336 CDD:214526 141/350 (40%)
KISc_CENP_E 6..329 CDD:276825 139/343 (41%)
SbcC 345..915 CDD:223496 53/278 (19%)
Mplasa_alph_rch 660..1366 CDD:275316
NUDE_C 828..>911 CDD:282704
Mplasa_alph_rch 1151..1951 CDD:275316
Smc 1676..2482 CDD:224117
Kinetochore-binding domain 2126..2476
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2355..2376
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2508..2533
Globular autoinhibitory domain. /evidence=ECO:0000250 2510..2698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2588..2701
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 140/346 (40%)
Kinesin 10..339 CDD:278646 137/337 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.