DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STAMBP and eIF3f2

DIOPT Version :10

Sequence 1:NP_006454.1 Gene:STAMBP / 10617 HGNCID:16950 Length:424 Species:Homo sapiens
Sequence 2:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster


Alignment Length:229 Identity:39/229 - (17%)
Similarity:84/229 - (36%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    18 LSQLGSAVEVNEDIPPRR----YFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHR 78
            ::.....:|:|....|..    :|.:|..:.|.||            ::::.|:....|..|.|.
  Fly    72 MAYASEVLELNMFAYPNERVLGWFCTGKSVSRSAS------------LIHDYYVRECCEGQPLHL 124

Human    79 DYKSAVIPEKKDT-VKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEK------KKEAEELARNM 136
            ...:|:..::..| :....|:..|..  .|..:......|.:..|.:.      :|::       
  Fly   125 LVDAALKNQRLSTRLYCAVEMGVPGG--TKGLMFSLVPLEISNENSDLVALRCIEKQS------- 180

Human   137 AIQQELEKEKQRVAQQKQQQLE--QEQFHAFEEMIR--NQELEKERLKIVQEFGKVDPGLGGPL- 196
              ||:..|:.:|...:..|.::  ::..|..:.::|  |..|.:::        |.|..:|..| 
  Fly   181 --QQQASKQMERFVPELAQVVDATRDMQHRLDLVLRYINDVLARKK--------KPDNVVGRSLY 235

Human   197 -----VPDLEKPSL---------DVFPTLTVSSI 216
                 ||.|:....         |:...:|:|::
  Fly   236 AALTAVPLLDSDKFRVMFNTNLRDMLMAITLSTM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STAMBPNP_006454.1 Interaction with CHMP3. /evidence=ECO:0000269|PubMed:17146056 1..127 19/119 (16%)
USP8_dimer 13..117 CDD:462647 17/103 (17%)
Interaction with STAM. /evidence=ECO:0000269|PubMed:10383417 227..231
MPN_AMSH_like 254..424 CDD:163697
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 39/229 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.