DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEXIM1 and Hexim

DIOPT Version :10

Sequence 1:NP_006451.1 Gene:HEXIM1 / 10614 HGNCID:24953 Length:359 Species:Homo sapiens
Sequence 2:NP_731932.1 Gene:Hexim / 41778 FlyBaseID:FBgn0038251 Length:360 Species:Drosophila melanogaster


Alignment Length:252 Identity:71/252 - (28%)
Similarity:108/252 - (42%) Gaps:76/252 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   125 SEASKLGAPAAGG--EEEWGQQQRQLG----------------------KKKHRR------RPSK 159
            :||.|.|.....|  |:|.|.|||.|.                      |:||||      :|.|
  Fly     2 AEAVKNGKNRHSGSAEKESGSQQRPLDSGGGGGASGGGGVAVGGGSGMPKRKHRRGKKSKMQPKK 66

Human   160 KKRHWKPYYKL--------TWEEKKKFDEKQSLRASRIRAEMFAKGQPVAPYNTTQFLMDDHDQE 216
            .|.|: |.:||        |.|.    :::|:.|...:|:...     :.||||.:|||::|..|
  Fly    67 TKNHY-PQWKLDMSTGAGATLEG----NQRQNSRTKLVRSRSL-----LVPYNTNRFLMEEHMSE 121

Human   217 EPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQN 281
                          ...||:.|:.|   |.:.:        |...||.::||:.|||...|.|:.
  Fly   122 --------------LHKDDSDDNCF---GSQTE--------DQVLFLSKEFSDVYERARLERLET 161

Human   282 MSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQ 338
            |||||||:|.:::|...|:.::.:...   ..:|...|.::|:|..|...||...|:
  Fly   162 MSKQELIQECMQIEDRYSKAQNISKEF---GAKLRAQDDKIRQLSRENQFLRTHLLR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEXIM1NP_006451.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..163 20/67 (30%)
Basic region, mediates nuclear localization and interaction with 7SK snRNA and NR3C1. /evidence=ECO:0000269|PubMed:15941832 150..177 14/40 (35%)
HEXIM 164..301 CDD:464638 42/144 (29%)
Interaction with P-TEFb 202..205 2/2 (100%)
Autoinhibitory acidic region, in absence of 7SK snRNA interacts with the basic region preventing interaction with P-TEFb and modulating subcellular localization 210..250 8/39 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..262 8/48 (17%)
Mediates interaction with CCNT1 286..314 6/27 (22%)
Required for inhibition of ESR1-dependent transcription 310..355 8/29 (28%)
HeximNP_731932.1 HEXIM 90..181 CDD:464638 37/120 (31%)

Return to query results.
Submit another query.