DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLCO1B1 and Oatp26F

DIOPT Version :9

Sequence 1:NP_006437.3 Gene:SLCO1B1 / 10599 HGNCID:10959 Length:691 Species:Homo sapiens
Sequence 2:NP_609055.2 Gene:Oatp26F / 33927 FlyBaseID:FBgn0051634 Length:692 Species:Drosophila melanogaster


Alignment Length:622 Identity:185/622 - (29%)
Similarity:311/622 - (50%) Gaps:65/622 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    47 IMKSSIIHIERRFEISSSLVGFIDGSFEIGNLLVIVFVSYFGSK--LHRPKLIGIGCFIMGIGGV 109
            ::..||..|||||.:.|..:|.:...:::.:...:|.|:|:|.:  ..:|:.|.||..:||:|.:
  Fly    85 LINVSISTIERRFGLRSRQMGLVASGYDLASFACLVPVTYYGGRRGASKPRFIAIGLIVMGMGSL 149

Human   110 LTALPHFFMGYYRYS-------KETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESG 167
            :..||:|.:|.||.:       :.|.:..:.||:.:::.|.:|           .:|:|   :|.
  Fly   150 VFLLPNFLVGNYRATIAEANVCETTGLPFNSNSSQSMTACELN-----------AMGEG---QSE 200

Human   168 SYMW-IYVFM-GNMLRGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLF 230
            :..| :::|: ..:|.|.|.:|:..||::|||:...:..||:||||...:|.:||.||:..|...
  Fly   201 NLTWTVWLFLAAQLLHGAGASPLFTLGVTYIDENVSKKMSSVYLGIYYTMATVGPAIGYVFGGQL 265

Human   231 SKMYVDIGYVDLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQT---PNKPQKERKA 292
            ..:|.|...||...:.:|.....|:|||||.|:.:....::.::|.|..|:.   ..|.|.||.:
  Fly   266 LLIYTDWMTVDPVQLSLTSDSKVWIGAWWLGFIFAAAMCLLIALPIFGYPKLLPGAEKLQLERVS 330

Human   293 SLSLHVLETNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFT 357
              ..|.  |..|.|.::|:          |.|..::..|:|.||.:....|....:.....|...
  Fly   331 --EAHA--TISEADDSSNV----------VRGLPRAVLSLLANPTFFFLNLAGATEGLVIAGFAA 381

Human   358 YVFKYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLSFY 422
            ::.|.:|.|:......:.:::|:||:|....|.|||||::||:.|...||.|. |..|....:.:
  Fly   382 FLPKQIENQFSISPMYSALVMGLITVPAGGGGTFLGGYLVKKWNLACRGIIKM-CLLATTVAALF 445

Human   423 LLYFFILCENKSVAGLTMTYDGNNPVTSHRDVP--LSYCNSDCNCDESQWEPVCGNNGITYISPC 485
            .:.|.:.|.|...||:|..|    .:....|.|  ::.|||:|.|..:.::|:||.:|:.|.|||
  Fly   446 TICFLVSCPNPKFAGVTTGY----KMQPSSDSPALVASCNSNCGCSRTNYDPICGVDGVMYYSPC 506

Human   486 LAGCKSSSGNKKPIVFYNCSCLEVTG-LQNRNYSAHLGECP--RDDACTRK-------FYFFVAI 540
            .|||...........::||||:|..| :.:.|.|:   |.|  |.||..||       ...|||:
  Fly   507 YAGCVQEEHANSLKRYHNCSCIEQVGFVDDGNPSS---EAPHFRPDATNRKCDSTCQTLPLFVAL 568

Human   541 QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCIKWSTN 605
            ..:.:.|:.|.....:...::.||.:.:|.|||...:.:|.||.|.||:.||||||.:||.|. .
  Fly   569 CFILMVFTFLATMPALSATLRCVQDDQRSFALGLQWIKVRLLGTIPAPLIFGALIDESCILWQ-E 632

Human   606 NC--GTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLY 640
            :|  ...|:|..|::...||....|:.:.::.|:|.:
  Fly   633 SCDKDAGGACLVYDNFYISRYMWLLALICKLGSVVFF 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLCO1B1NP_006437.3 OATP 29..621 CDD:281175 180/601 (30%)
MFS 31..>427 CDD:119392 110/393 (28%)
KAZAL_SLC21 455..508 CDD:238650 21/54 (39%)
Oatp26FNP_609055.2 OATP 66..647 CDD:281175 180/598 (30%)
MFS 69..>318 CDD:119392 72/246 (29%)
KAZAL_SLC21 476..529 CDD:238650 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X98
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.