DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCGN and Cam

DIOPT Version :9

Sequence 1:NP_008929.2 Gene:SCGN / 10590 HGNCID:16941 Length:276 Species:Homo sapiens
Sequence 2:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster


Alignment Length:164 Identity:46/164 - (28%)
Similarity:75/164 - (45%) Gaps:28/164 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    15 AGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIR 79
            |.|.:.:..||.|..|.|..|||..    ::..||.:.|  :|.|    |..:...||..:|.|.
  Fly    11 AEFKEAFSLFDKDGDGTITTKELGT----VMRSLGQNPT--EAEL----QDMINEVDADGNGTID 65

Human    80 MKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKA 144
            ..|    ||:      ::.|:....||..|..:.:|.:|.|.:|||||||||:.:.:|       
  Fly    66 FPE----FLT------MMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL------- 113

Human   145 ISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARIL 178
             .|...:|....|::..|.:.||:::..:...::
  Fly   114 -GEKLTDEEVDEMIREADIDGDGQVNYEEFVTMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCGNNP_008929.2 EFh_HEF_SCGN 17..273 CDD:320078 45/162 (28%)
EF-hand motif 17..45 CDD:320078 9/27 (33%)
EF-hand motif 62..91 CDD:320078 8/28 (29%)
EF-hand motif 109..138 CDD:320078 13/28 (46%)
EF-hand motif 153..182 CDD:320078 4/26 (15%)
EF-hand motif 201..230 CDD:320078
EF-hand motif 245..273 CDD:320078
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 46/164 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.