DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CENPA and His3:CG33803

DIOPT Version :9

Sequence 1:NP_001800.1 Gene:CENPA / 1058 HGNCID:1851 Length:140 Species:Homo sapiens
Sequence 2:NP_001027285.1 Gene:His3:CG33803 / 3772149 FlyBaseID:FBgn0053803 Length:136 Species:Drosophila melanogaster


Alignment Length:132 Identity:67/132 - (50%)
Similarity:84/132 - (63%) Gaps:9/132 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     5 RRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGW--LKEIRKLQKSTHLLIRKLPF 67
            |:|...:|||::    ..|....:..|:.|.....| |.|.|.  |:|||:.||||.||||||||
  Fly     9 RKSTGGKAPRKQ----LATKAARKSAPATGGVKKPH-RYRPGTVALREIRRYQKSTELLIRKLPF 68

Human    68 SRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRI 132
            .||.|||...|.  .|..:|:.|::|||||:||:||.||||..|..:||.|||:.|||:||||||
  Fly    69 QRLVREIAQDFK--TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131

Human   133 RG 134
            ||
  Fly   132 RG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CENPANP_001800.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 11/40 (28%)
H3 34..137 CDD:128705 60/103 (58%)
Important for flexibility of DNA ends that protrude from nucleosomes. /evidence=ECO:0000269|PubMed:27499292 39..54 8/16 (50%)
CATD. /evidence=ECO:0000269|PubMed:15282608, ECO:0000269|PubMed:7962047 75..116 18/40 (45%)
His3:CG33803NP_001027285.1 PTZ00018 1..136 CDD:185400 67/132 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.