DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdelr3 and KdelR

DIOPT Version :9

Sequence 1:NP_598851.2 Gene:Kdelr3 / 105785 MGIID:2145953 Length:214 Species:Mus musculus
Sequence 2:NP_477296.1 Gene:KdelR / 34427 FlyBaseID:FBgn0267330 Length:212 Species:Drosophila melanogaster


Alignment Length:211 Identity:140/211 - (66%)
Similarity:180/211 - (85%) Gaps:0/211 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MNVFRILGDLSHLLAMILLLVKIWRSKSCAGISGKSQILFALVFTTRYLDLFSNFISIYNTVMKV 65
            ||:||..|||||:.|:|:||:|||:::||||||||||||||:|:.|||||||:.::|:||:||||
  Fly     1 MNIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLDLFTTYVSLYNSVMKV 65

Mouse    66 VFLLCAYVTVYMIYWKFRKTFDIENDTFRLEFLLVPVTGLSFLVNYSYTPMEVLWTFSIYLESVA 130
            :||..:..|||::|.||:.|:|..:|:||:||||||...||.::|:.:|.|||||||||||||||
  Fly    66 LFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLVPCALLSLVINHEFTVMEVLWTFSIYLESVA 130

Mouse   131 ILPQLFMISKTGEAETITTHYLFFLGLYRLLYLANWIRRYQTENFYDQISVVSGVVQTIFYCDFF 195
            ||||||::|:|||||:||:||||.||.||.|||.||:.||..|:.||.|::.:|||||:.|||||
  Fly   131 ILPQLFLVSRTGEAESITSHYLFALGSYRALYLLNWVYRYMVESHYDLIAIFAGVVQTVLYCDFF 195

Mouse   196 YLYVTKVLKGKKLSLP 211
            |||:|||||||||.||
  Fly   196 YLYITKVLKGKKLQLP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Kdelr3NP_598851.2 ER_lumen_recept 28..169 CDD:366320 94/140 (67%)