DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPC2 and Npc2h

DIOPT Version :9

Sequence 1:NP_001350617.1 Gene:NPC2 / 10577 HGNCID:14537 Length:174 Species:Homo sapiens
Sequence 2:NP_001247376.1 Gene:Npc2h / 43649 FlyBaseID:FBgn0039801 Length:157 Species:Drosophila melanogaster


Alignment Length:157 Identity:41/157 - (26%)
Similarity:72/157 - (45%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     4 LAATFLLLALSTAAQAEPVQFKDC-GSVDGV-IKEVNVSPCP----TQPCQLSKGQSYSVNVTFT 62
            |...|.|:..|.:  ||.|.|:.| .|||.. |.:|.|:|||    ...|.:.:...::::..||
  Fly     8 LPVAFALVLSSVS--AEIVNFQTCEDSVDSCSISQVRVTPCPEANANAACHIRRRHRFTMSFDFT 70

Human    63 SNIQSKSSKAVVHGILMG------VPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPS 121
            .:..:.:..|     .:|      |.:|....:.:.||. ..||::...|.:|.|.:|..:.:|.
  Fly    71 PHFDADTLVA-----SLGWAKSENVELPLLTMDQEACKY-TTCPVRSGVTQTYTNNMPADARFPL 129

Human   122 IKLVVEWQLQDDKNQSLFCWEIPVQIV 148
            ....:.|.|:|..:|...|:.|.:::|
  Fly   130 SPYTIRWALKDPVSQKRCCFTIDIKVV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 33/132 (25%)
Npc2hNP_001247376.1 Npc2_like 26..153 CDD:238458 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.