DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPC2 and Npc2f

DIOPT Version :9

Sequence 1:NP_001350617.1 Gene:NPC2 / 10577 HGNCID:14537 Length:174 Species:Homo sapiens
Sequence 2:NP_651219.1 Gene:Npc2f / 42864 FlyBaseID:FBgn0039154 Length:170 Species:Drosophila melanogaster


Alignment Length:125 Identity:34/125 - (27%)
Similarity:56/125 - (44%) Gaps:3/125 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    24 FKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKS-SKAVVHGILMGVPVPFPI 87
            |:||||:..| ..:::..|.|.||.:::..:..|.|.|..|....| .|..|..:...:.....|
  Fly    46 FEDCGSLYQV-SYLDIESCTTLPCSMARNATIKVTVRFDDNGNGVSFLKHEVRWVFNYIKTQAAI 109

Human    88 PEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147
             .||.|.....|........:|...:.|....|.:|..:.|:.:|..:|:|.|:::||.|
  Fly   110 -TPDPCDGDHGCIESASGGKAYWANIFVNETLPVMKGSMLWESKDANDQNLICFQVPVVI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 31/121 (26%)
Npc2fNP_651219.1 Npc2_like 46..166 CDD:238458 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.