DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPC2 and Npc2b

DIOPT Version :9

Sequence 1:NP_001350617.1 Gene:NPC2 / 10577 HGNCID:14537 Length:174 Species:Homo sapiens
Sequence 2:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster


Alignment Length:122 Identity:33/122 - (27%)
Similarity:59/122 - (48%) Gaps:12/122 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    36 EVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFP----------IPEP 90
            :|::|.||...|.|.:....|:.:........:...:.:.||::.||:|||          |.:.
  Fly    38 DVSISNCPKSKCILKRNTEASIQMKIRPERDFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDE 102

Human    91 DGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147
            .|.|. :.||::..:.|:|.|...:...||::.|.:.|.| .||:....|::||.:|
  Fly   103 AGEKK-VGCPLKAGQVYTYKNSFKILPVYPTVSLEIHWGL-GDKHGDAACFQIPAKI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 31/118 (26%)
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49115
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.