DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPC2 and Npc2d

DIOPT Version :9

Sequence 1:NP_001350617.1 Gene:NPC2 / 10577 HGNCID:14537 Length:174 Species:Homo sapiens
Sequence 2:NP_649975.1 Gene:Npc2d / 41232 FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster


Alignment Length:156 Identity:44/156 - (28%)
Similarity:68/156 - (43%) Gaps:8/156 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     9 LLLALSTAAQAEP-VQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKA 72
            |||:|:.|.|..| ...|.|........||.|..|.|.|||:.||.:....:.|..:........
  Fly    13 LLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCVTPPCQIVKGTTQKFEIDFAVDKYITQLTT 77

Human    73 VVHGILMG-VPVPFPIPEP-----DGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQ 131
            :|....:| :.||:.:|..     ...:.|..||:...:..|||...|: .|||.|.:.:|..|.
  Fly    78 LVKATTLGIITVPYELPADVAAVCPNLQYGAYCPLYPTEDVSYLFTFPI-GEYPEIGVKIEIYLV 141

Human   132 DDKNQSLFCWEIPVQIVSLSGGERAW 157
            |..|:...|:...:::|..:||...:
  Fly   142 DQDNEIATCFVCDIKVVKGNGGNTVY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 34/126 (27%)
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 34/126 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.