DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPC2 and Npc2a

DIOPT Version :9

Sequence 1:NP_001350617.1 Gene:NPC2 / 10577 HGNCID:14537 Length:174 Species:Homo sapiens
Sequence 2:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster


Alignment Length:132 Identity:49/132 - (37%)
Similarity:76/132 - (57%) Gaps:3/132 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    19 AEPVQFKDCGSVDGVIKEVNVSPCPT--QPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGV 81
            |..::|.||||..|....|.:..|.|  ..|.|.:..:.|.::.|....::.:.|.||||.::|:
  Fly    16 AGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVVHGKVLGI 80

Human    82 PVPFPIPEPDGC-KSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPV 145
            .:|||:..||.| .||:.||::||::|.|...|||...||.:.::|:|:|||.....:.|.|||.
  Fly    81 EMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPA 145

Human   146 QI 147
            :|
  Fly   146 KI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 46/123 (37%)
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 46/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149211
Domainoid 1 1.000 106 1.000 Domainoid score I6614
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4697
Inparanoid 1 1.050 106 1.000 Inparanoid score I4945
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49115
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 1 1.000 - - FOG0007859
OrthoInspector 1 1.000 - - oto90049
orthoMCL 1 0.900 - - OOG6_106086
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4693
SonicParanoid 1 1.000 - - X5814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.