DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEL and Nlg3

DIOPT Version :9

Sequence 1:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens
Sequence 2:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster


Alignment Length:721 Identity:188/721 - (26%)
Similarity:283/721 - (39%) Gaps:195/721 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    26 VYTEGGFVEGVNKKL-GLLGDSVDIFKGIPFAAP---TKALENPQPHPGWQGTLKAKNFKKRCLQ 86
            :.|..|.:.||..:| |...|.|:.::|||:|:|   ......|.....|.|..||..|...|.|
  Fly   158 INTRNGAISGVIVQLDGRHLDPVEAYRGIPYASPPVGNLRFMPPVSAAMWSGVKKADRFSPVCPQ 222

Human    87 --------ATITQDSTYG---------------DEDCLYLNIWVPQGRKQV-SRD---------- 117
                    ....:....|               .||||||||:||   .|| |||          
  Fly   223 RLPDIHNETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVP---IQVGSRDSSGSSSSSSA 284

Human   118 -------------------------------LPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIA 151
                                           .||:::::|.::...||:.        |||..:|
  Fly   285 GSSSSGSGGSSSSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNP--------YDGSVLA 341

Human   152 TRGNVIVVTFNYRVGPLGFLSTGD---ANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGE 213
            :.|.::|||.|||:|.||||:...   :.||.||||.|...|:.|:|.||||||||||:|||.|.
  Fly   342 SYGQILVVTINYRLGVLGFLNANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNSITLAGH 406

Human   214 SAGGASVS--LQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDA--ARM 274
            ..|.|.|.  :.:::.....|..|||..||..|:||.:..||..:|..||..|.| ..|.  |.:
  Fly   407 GTGAACVHFLISSMAVPEGLLFNRAILMSGSGLAPWSLVSNPAKYAAIVAHHVNC-ASDLPHAHL 470

Human   275 AQCLKVTDPRALTLAYKVPLAGLEYPMLHYVGFVPVID------GDFIPADPINLYANAADIDYI 333
            .:||:   .:.|.....||:...|:..    .|.|.||      ||::|..|.:..|.|......
  Fly   471 MKCLR---EKTLDQLLSVPIRPPEFGF----AFGPSIDGVVIDGGDYVPPAPGSPAAQAQAQAST 528

Human   334 AGTNNMDGH--IFAS--------------IDMPAINKGNK-----KVTEEDFYKLVSEFTITKGL 377
            |..|.:.|.  |.|:              :...||||.::     .||..:.:...:...:..|:
  Fly   529 AAGNGLGGEAGIAAAGGWGTPGQLENIVLMRKTAINKLSRYDLMAGVTRAEAFFSFNSGDVQYGI 593

Human   378 RGAK----------------------TTFDVYTESWAQDPSQE--NKKKTVVDFETDVLFLVPTE 418
            ...:                      |..:.||: | :.|.|.  |.:...::..:|...:.|..
  Fly   594 EADRRSRILKAYVRNTYTFHLNEIFATIVNEYTD-W-ERPVQHPINIRDETLEALSDAQVVAPAA 656

Human   419 IALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFA-----TPTGYRPQDR 478
            ..:..|.|:.::  :|.|:|.:.:|...||:..|..|.:|:.|:||.|..     ....|...:.
  Fly   657 QTVDLHSADHRN--SYLYVFDYQTRFGDYPQRQGCIHGEDLPYIFGAPLVGGFNHFTRNYTKTEI 719

Human   479 TVSKAMIAYWTNFAKTGDPNMGDSAVPTH-------------WEPYTTENSGYLEITKKMGSSSM 530
            ::|:.::.||:||.:||:||  :.....|             |..|.:.:..||....|   ..:
  Fly   720 SLSEVVMFYWSNFVRTGNPN--EQMETEHGSRQERSRYKTIEWTAYESVHKKYLNFDTK---PKL 779

Human   531 KRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPT------GDSETAPVPPTGDSG 589
            |...|.:.|.:|      |..:.|..    .|.||:    ||..      .|.|...:|  .|:.
  Fly   780 KNHYRAHRLSFW------LNLIPDLH----KPGGDN----VPAAHHQLHDDDDEDNNIP--SDAS 828

Human   590 APPVPP 595
            ..|:.|
  Fly   829 VKPLNP 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CELNP_001798.3 Heparin-binding 21..121 38/163 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753 11/47 (23%)
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745 11/43 (26%)
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 174/660 (26%)
Aes <313..>410 CDD:223730 45/104 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43903
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.