DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEL and alpha-Est2

DIOPT Version :9

Sequence 1:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:521 Identity:155/521 - (29%)
Similarity:235/521 - (45%) Gaps:73/521 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    28 TEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTKA---LENPQPHPGWQGTLKAKNFKKRCLQATI 89
            |:.|.|.|:.:|.....:....|:|||:|.|...   ...|||...|||.|.....:.:.:|..:
  Fly    37 TKYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPMQRNM 101

Human    90 TQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRG 154
            ......|.||||:||::|...:.:  :.|||::|||||.|..|......:..:|.       .:.
  Fly   102 LLGIVEGSEDCLHLNVYVKALKSE--KPLPVIVWIYGGGFQKGEASRDIYSPDYF-------MKK 157

Human   155 NVIVVTFNYRVGPLGFLSTGDANL--PGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGG 217
            .|:.|..|||:..|||||..|..|  |||.||:||.||:.|:.:|||.|.||||||||.|||||.
  Fly   158 PVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAGS 222

Human   218 ASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTD 282
            |||.:...:...:||..:||.|||.|||.|| :.....||.::|:.:|.. ||.         .|
  Fly   223 ASVHVMMTTEQTRGLFHKAIMQSGCALSEWV-ESPDNNWAFRLAQNLGYK-GDE---------KD 276

Human   283 PRALTLAYKV---PLAGLEYPMLH--------YVGFVPVI-----DGDFIPADPINLYANA--AD 329
            ...|:...||   .:|.::..:::        ...|.|||     |...:|....:|.:.|  .|
  Fly   277 ADVLSFLSKVCARQIAAIDQDVINLDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSEAWGND 341

Human   330 IDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLV-SEFTITKGLRGAKTTFDVYTESWAQ 393
            |..|.|.|:.:| :|:   ...:.|....:  ::|:.:: .|...|..|.|.........:.:..
  Fly   342 IPVIVGGNSFEG-LFS---YQLVRKDPWAL--KNFHNILPREVRETSSLEGQDLLVRRLKQLYFN 400

Human   394 DPSQENKKKTVVDFETDVLF-----LVPTEIALAQHRANAKSAKTYAYLFSHPS-------RMPV 446
            :..||:.:.    ||...:|     ...|...:...::.|....||.|.|...|       |:..
  Fly   401 NEMQESMEM----FEALNIFSHRQIWHDTHRFILARQSYAPKTPTYLYRFDFDSPHFNQFRRLVC 461

Human   447 YPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPN---MGDSAVPTHW 508
            ..:..|..|||::.|:|....|:.......:....:.|:..||:||.:|:||   :|.:    .|
  Fly   462 GDRIRGVAHADELSYLFYNIIASKLDKSSMEYKTIERMVGMWTSFASSGNPNCPELGSA----KW 522

Human   509 E 509
            |
  Fly   523 E 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CELNP_001798.3 Heparin-binding 21..121 29/95 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 153/519 (29%)
Aes <117..>221 CDD:223730 49/112 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.