DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEL and Nrt

DIOPT Version :9

Sequence 1:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens
Sequence 2:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster


Alignment Length:555 Identity:141/555 - (25%)
Similarity:202/555 - (36%) Gaps:179/555 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    31 GFVEGVNKKLGLLGDSVDIFKGIPFAAPTKALENPQPHPG---------WQGTLKAKNFKKRCLQ 86
            |.||||.:      |....|:|||:|.|  .::..:..|.         |..||:..|....|.|
  Fly   368 GPVEGVKE------DGAFAFRGIPYAKP--PVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQ 424

Human    87 ATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIA 151
             .:...:|.||||||||::..|..|  .:..|||::.| |...|.|...|      .|......:
  Fly   425 -RLGNGTTVGDEDCLYLDVVTPHVR--YNNPLPVVVLI-GAESLAGPSPG------ILRPSARYS 479

Human   152 TRGNVIVVTFNYRVGPLGFLS----TGDANLP--GNYGLRDQHMAIAWVKRNIAAFGGDPNNITL 210
            ...:||.|..|:|:|..|||:    |.:|:.|  |||.|.|....:.|:|.||..|||||.::||
  Fly   480 RSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTL 544

Human   211 FGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMA 275
            .|..||...|:|...|...|||..||.:.||.|:.|    ..||..:.|..|::...:..|.  .
  Fly   545 LGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILP----GKPLSESGKQNEQLMATLECAD--I 603

Human   276 QCLKVTDPRALTLAYKVPLAGLEYPMLHYVGFVP---------------VIDGDFIPADPINLY- 324
            |||:......|..|  .|...|.:|:     .:|               |:|||.:...|.:.: 
  Fly   604 QCLREASSERLWAA--TPDTWLHFPV-----DLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWK 661

Human   325 ---ANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDV 386
               ||                     |.|.:..|                         .|..:.
  Fly   662 REQAN---------------------DKPVLVMG-------------------------ATAHEA 680

Human   387 YTE-------SWAQDPSQ---ENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFS-- 439
            :||       :|.::..:   ||.:...:....:|:           .:.||.|   ||.|.|  
  Fly   681 HTEKLRELHANWTREEVRAYLENSQIGALGLTDEVI-----------EKYNASS---YASLVSII 731

Human   440 -----------HPSRMPVYPKWV-----GADHA----DDIQYVFGKPFATPTGYRP----QDRTV 480
                       :..:.|..|.:|     |.|..    .|:|.:.|:       |.|    |.|.|
  Fly   732 SDIRSVCPLLTNARQQPSVPFYVVTQGEGPDQLATVDADVQAILGR-------YEPHTVEQRRFV 789

Human   481 SKAMIAYWTNFAKTGDP----------NMGDSAVP 505
            | ||...:..:...|..          |:|..|.|
  Fly   790 S-AMQQLFYYYVSHGTVQSFVQNRRVINVGQDAQP 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CELNP_001798.3 Heparin-binding 21..121 32/98 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 141/555 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.