DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEBPG and Irbp18

DIOPT Version :9

Sequence 1:NP_001239225.1 Gene:CEBPG / 1054 HGNCID:1837 Length:150 Species:Homo sapiens
Sequence 2:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster


Alignment Length:111 Identity:33/111 - (29%)
Similarity:64/111 - (57%) Gaps:10/111 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    44 KAVAPSKQSKKSSPMDRNSDE--YRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEA 106
            |..|.|......||:..::|:  |:::|::||.||:::|.|:|:.|::..:|::.|:::|:.|:.
  Fly     5 KRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKV 69

Human   107 KIKLLTKELSVLKDLFL-----EHAHNLADNVQSISTENTTADGDN 147
            :|:...|.:|.|:||.:     |..|.:   :|.|..|......||
  Fly    70 QIETSEKHISTLRDLIIQGEKTEDGHRI---IQEILAEPDPDPKDN 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CEBPGNP_001239225.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..94 16/51 (31%)
bZIP_CEBPG 60..120 CDD:269861 19/61 (31%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 66..93 9/26 (35%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 97..118 6/20 (30%)
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 19/58 (33%)
coiled coil 25..83 CDD:269841 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5399
Isobase 1 0.950 - 0 Normalized mean entropy S4384
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41706
orthoMCL 1 0.900 - - OOG6_108546
Panther 1 1.100 - - LDO PTHR23334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.