DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BATF and kay

DIOPT Version :9

Sequence 1:NP_006390.1 Gene:BATF / 10538 HGNCID:958 Length:125 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:144 Identity:39/144 - (27%)
Similarity:65/144 - (45%) Gaps:27/144 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     4 SSDSSDSSFSRSPP-------PGKQDS---SDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLES 58
            |..||:::.|.:|.       |.:..:   .::.:|..|||:|:.||.:.|:|:..:.:.|..|.
  Fly   386 SVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEV 450

Human    59 EDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLC--------SVLAASTPSPPEVVYSA----- 110
            |.|||:..::||||:.||........:|.:|...|        ||:..:....|..:.||     
  Fly   451 EQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGS 515

Human   111 ----HAFHQPHVSS 120
                |..|..:.||
  Fly   516 GASSHHNHNSNDSS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BATFNP_006390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 16/63 (25%)
bZIP_BATF 26..83 CDD:269849 21/56 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 28..50 9/21 (43%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 54..75 10/20 (50%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 22/60 (37%)
coiled coil 421..480 CDD:269869 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.