DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HYOU1 and CG7182

DIOPT Version :9

Sequence 1:XP_005271449.1 Gene:HYOU1 / 10525 HGNCID:16931 Length:1000 Species:Homo sapiens
Sequence 2:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster


Alignment Length:454 Identity:101/454 - (22%)
Similarity:186/454 - (40%) Gaps:96/454 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    38 VDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQH 102
            :.:|:.::.:|.|:.....|::.||:..|.:...:        ..|.|:.:     :..|...| 
  Fly     7 IKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACL--------LWDGASEI-----ECGLTAKQ- 57

Human   103 LLGKQADNPHVAL---YQARFPEHELT--------------FDPQRQTVHFQISSQLQFSPE--- 147
               |.|:.|..|:   :|...|:.|||              ||  ::.:.|::...:....|   
  Fly    58 ---KMANRPRQAVAHSFQLLQPKEELTEEKLSSALREIPCDFD--KEELVFRMEHTVPSDREDQD 117

Human   148 ---------------EVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGL 197
                           |:|...|..:.....|..:.||  ||:::|.::..:..:.:..||:.||.
  Fly   118 DRVVTKDLSAYQVTVELLRAELELAHQYHTDGEQAPI--AVLSIPSYYPASAYKLLADAAQTAGF 180

Human   198 KVLQLINDNTATALSYGV-----FRRKDINTTA-----QNIMFYDMGSGSTVCTIVTYQMVKTKE 252
            .|.|:|.:.||..|.|.:     .:|:.:.|..     .:|.||.:.:|..| .:.|:       
  Fly   181 HVAQIITEPTAAVLGYSIGEEQTEQRRHVLTIKCGGLYSDIAFYSVQNGLFV-QLATF------- 237

Human   253 AGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLK 317
             |..|            :||.:    ..|.|.....|:.:.:...|..|:.|::||:...|...|
  Fly   238 -GPFP------------IGGRQ----FTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAANCK 285

Human   318 TVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCA----DLFERVPGPVQQALQSAEMSLDEIE 378
            .:|:........|:.|||.||:.|:::|..||.|..    :|.:::...|:|| |.....|.:|:
  Fly   286 HILTTMPSTQLYIDSLMDGVDYNAQMSRARFESLIQPVINNLIQQLGECVEQA-QKEHPGLSKID 349

Human   379 QVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVV 442
            .::|:|...::|::|..:.......:|..:.:|||..|:|...||..|....:.:.....|.||
  Fly   350 DIVLLGATMQIPKLQAAVGARFPDAKLHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEEDCVV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 101/454 (22%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 96/434 (22%)
PHA00666 601..>739 CDD:222808
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 95/433 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.