DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF211 and Zif

DIOPT Version :9

Sequence 1:NP_001252526.1 Gene:ZNF211 / 10520 HGNCID:13003 Length:629 Species:Homo sapiens
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:370 Identity:91/370 - (24%)
Similarity:135/370 - (36%) Gaps:74/370 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   144 EHEETPSEQRI-----------SGERVP---------------QFRTSKEGSSSQNADSC-EICC 181
            |.||:|:|..|           ..|.:|               |||........:..:.| |:..
  Fly    29 EGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQFREKALRKQMEIEEYCRELGL 93

Human   182 LVLRDILHLAEHQGTNCGQKLHTCGKQFYISANLQQHQRQHITEAPFRSY--VDTASFTQSCIVH 244
            |...|::.:.|..|:.     ..|.::.||.......:.:|..|.....|  ||| |..|.||..
  Fly    94 LDESDVMMIKEEDGSQ-----QQCDEEMYILEETTTGEEEHQEEKGHEEYLEVDT-SDQQECIGD 152

Human   245 VSEKPFTCREIRKDFLANMRFLHQDATQTGEKPNNSNKCAVAFYSGKSHHNWGKCSKAFSHIDTL 309
                  |...:..::...|               ||::..:...|.|.:..              
  Fly   153 ------TIEYLEDNYTIEM---------------NSDQTEIVLESEKQYEE-------------- 182

Human   310 VQDQRILTREGLFECSKCGKACTRRCNLIQHQKVHSEERPYECNECGKFFTYYSSFIIHQRVHTG 374
            ...|::..:|......|..:...||..........:|:..|.|:.||.|:......:.|:|.|.|
  Fly   183 TPSQQLALQEAAKASLKARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDG 247

Human   375 ERPYACPECGKSFSQIYSLNSHRKVHTGERPYECGECGKSFSQRSNLMQHRRVHTGERPYECSEC 439
            ...|||..|...|.....|..|...|||.:||:|..|.:.|...|.|..|..||.|.:||.|..|
  Fly   248 ICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVC 312

Human   440 GKSFSQNFSLIYHQRVHTGERPHECNECGKSFSRSSSLIHHRRLH 484
            .|:|:...||..|:.:|:..:.:.|:.|.|.|    .|:||.|.|
  Fly   313 DKAFAYAHSLTKHELIHSDIKLYRCDYCNKDF----RLLHHMRQH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF211NP_001252526.1 KRAB 46..106 CDD:214630
KRAB 46..85 CDD:279668
COG5048 244..615 CDD:227381 61/241 (25%)
C2H2 Zn finger 299..316 CDD:275368 1/16 (6%)
C2H2 Zn finger 324..344 CDD:275368 3/19 (16%)
zf-H2C2_2 336..361 CDD:290200 6/24 (25%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 368..389 CDD:290200 9/20 (45%)
C2H2 Zn finger 380..400 CDD:275368 5/19 (26%)
zf-H2C2_2 392..417 CDD:290200 10/24 (42%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
zf-H2C2_2 420..445 CDD:290200 11/24 (46%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
zf-H2C2_2 448..473 CDD:290200 8/24 (33%)
C2H2 Zn finger 464..484 CDD:275368 8/19 (42%)
zf-C2H2 518..540 CDD:278523
C2H2 Zn finger 520..540 CDD:275368
zf-H2C2_2 532..557 CDD:290200
C2H2 Zn finger 548..568 CDD:275368
zf-H2C2_2 560..585 CDD:290200
C2H2 Zn finger 576..596 CDD:275368
zf-H2C2_2 588..611 CDD:290200
C2H2 Zn finger 604..624 CDD:275368
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 11/57 (19%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
COG5048 <250..369 CDD:227381 40/108 (37%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 266..288 CDD:290200 9/21 (43%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
C2H2 Zn finger 337..353 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.