DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEBPD and Irbp18

DIOPT Version :9

Sequence 1:NP_005186.2 Gene:CEBPD / 1052 HGNCID:1835 Length:269 Species:Homo sapiens
Sequence 2:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster


Alignment Length:86 Identity:22/86 - (25%)
Similarity:49/86 - (56%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   176 PAREKSAGKR--------GPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEK 232
            ||::::|...        .|....|.|:::|::||.||:::|:|.|:..:|.::::.:|..:|:.
  Fly     2 PAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDA 66

Human   233 LHQRVEQLTRDLAGLRQFFKQ 253
            |..::|...:.::.||....|
  Fly    67 LKVQIETSEKHISTLRDLIIQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CEBPDNP_005186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..219 14/50 (28%)
bZIP_CEBPD 188..252 CDD:269862 17/63 (27%)
coiled coil 191..249 CDD:269862 16/57 (28%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 9/26 (35%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 7/28 (25%)
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 16/58 (28%)
coiled coil 25..83 CDD:269841 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41706
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.