DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIB1 and CG3565

DIOPT Version :9

Sequence 1:XP_006720438.1 Gene:CIB1 / 10519 HGNCID:16920 Length:264 Species:Homo sapiens
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:253 Identity:52/253 - (20%)
Similarity:95/253 - (37%) Gaps:53/253 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     6 SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQ-VPFEQILSLPELKAN-- 67
            :||:|:.:..:.:|.     .|::.:.:|.         :.:..||: :..:|:.:|.||...  
  Fly    25 ARLAKDSIFSHNELI-----SIVMLYHKFV---------LVNGPRAKYMTIQQLSALMELLFEIV 75

Human    68 ------PFKERICRVFSTSP----AKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGT 122
                  ....||.....:.|    :...:..|.|:.|.:|:. |....:|..:||.::|..|...
  Fly    76 DRDLIATIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYF-TKDLQLKMEFAFSVYDKSDSKQ 139

Human   123 LNREDLSRLV-NCLTGEGEDTRLSAS-EMKQLIDNILEESDIDRDGTINLSEFQHVISRSP---- 181
            ||.|.:...| .....|.||..:... :||::   :..:.|:|:|..|.:.|:..|:.|.|    
  Fly   140 LNGEQVGFFVGKFFESEDEDESIELRLDMKEM---LFLKFDLDKDTNIGVDEYYEVVRRQPMLLE 201

Human   182 DFARYDSGPPSFWVPAGSDLLPLGLGHGYRRWCQGERKPQSPHTGPAKLAVSPRAGAA 239
            .|.|.        .|....:..|.|......|......|        ::.:.|..|.|
  Fly   202 CFGRV--------FPPNPQMEVLALCANVMSWFDDSPNP--------RIMIKPDGGKA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIB1XP_006720438.1 EF-hand_8 82..132 CDD:290545 13/49 (27%)
EF-hand_7 109..177 CDD:290234 18/69 (26%)
EFh 111..178 CDD:238008 19/68 (28%)
CG3565NP_611942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.