| Sequence 1: | NP_006371.2 | Gene: | APPBP2 / 10513 | HGNCID: | 622 | Length: | 585 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261780.1 | Gene: | Klc / 39445 | FlyBaseID: | FBgn0010235 | Length: | 508 | Species: | Drosophila melanogaster |
| Alignment Length: | 217 | Identity: | 57/217 - (26%) |
|---|---|---|---|
| Similarity: | 102/217 - (47%) | Gaps: | 17/217 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Human 342 VHQYSS-GKFDNALFHAERAIGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQE 405
Human 406 AHDLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEV 470
Human 471 ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNY-EKVF 534
Human 535 EYHNVLSNWNRLRDRQYSVTDA 556 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| APPBP2 | NP_006371.2 | TPR 1 | 50..83 | ||
| TPR 2 | 120..153 | ||||
| TPR 3 | 206..239 | ||||
| TPR_12 | 284..363 | CDD:290160 | 7/21 (33%) | ||
| TPR 4 | 288..321 | ||||
| TPR 5 | 333..367 | 7/25 (28%) | |||
| TPR_12 | 427..504 | CDD:290160 | 25/76 (33%) | ||
| TPR_10 | 428..466 | CDD:290111 | 14/37 (38%) | ||
| TPR 6 | 429..462 | 12/32 (38%) | |||
| TPR repeat | 429..457 | CDD:276809 | 10/27 (37%) | ||
| TPR repeat | 470..501 | CDD:276809 | 10/30 (33%) | ||
| TPR 7 | 471..505 | 10/33 (30%) | |||
| TPR 8 | 514..547 | 9/33 (27%) | |||
| Klc | NP_001261780.1 | TPR_12 | 185..258 | CDD:315987 | 17/75 (23%) |
| TPR repeat | 187..214 | CDD:276809 | 7/20 (35%) | ||
| TPR_12 | 226..302 | CDD:315987 | 22/86 (26%) | ||
| TPR repeat | 228..256 | CDD:276809 | 7/38 (18%) | ||
| TPR_12 | 269..344 | CDD:315987 | 25/75 (33%) | ||
| TPR repeat | 270..298 | CDD:276809 | 10/27 (37%) | ||
| TPR_12 | 310..384 | CDD:315987 | 20/77 (26%) | ||
| TPR repeat | 311..341 | CDD:276809 | 10/30 (33%) | ||
| TPR_12 | 353..469 | CDD:315987 | 11/45 (24%) | ||
| TPR repeat | 354..381 | CDD:276809 | 6/26 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1840 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||