DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEMA6C and Sema2a

DIOPT Version :9

Sequence 1:NP_001171532.1 Gene:SEMA6C / 10500 HGNCID:10740 Length:962 Species:Homo sapiens
Sequence 2:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster


Alignment Length:585 Identity:193/585 - (32%)
Similarity:295/585 - (50%) Gaps:103/585 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     9 PLLLLLLLL--SLPHTQAAFPQD-----PLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRF 66
            |||.|||||  |:..|.|.:...     ..|....:.||.:  ::.:...|.......|..:.|.
  Fly     8 PLLALLLLLCSSVSETAADYENTWNFYYERPCCTGNDQGNN--NYGKHGADHVREFNCGKLYYRT 70

Human    67 LTLNR---TLLVAARDHVFSFDLQ------AEEEGEGLVPNKYLTWRSQDVENCAVRGK-LTDEC 121
            ..:|.   ||.|.|.|.||..:||      ...:...|.|.:      .||.:|..:|| ...:|
  Fly    71 FHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLEPTR------DDVVSCVSKGKSQIFDC 129

Human   122 YNYIRVLVPWD-SQTLLACGTNSFSPVCRSY----GITSLQQEGEELS---GQARCPFDATQSNV 178
            .|::||:...| ...|..||||:.:|  :.|    .:|.|.:....:.   |.|:||:|...::.
  Fly   130 KNHVRVIQSMDQGDRLYVCGTNAHNP--KDYVIYANLTHLPRSEYVIGVGLGIAKCPYDPLDNST 192

Human   179 AIFAEG-------SLYSATAADFQASDAVVYRSLGPQPPL-------------RSAKYDSKWLRE 223
            ||:.|.       .|||.|.|:|..:|.|::|:     .|             |:.|||||||.:
  Fly   193 AIYVENGNPGGLPGLYSGTNAEFTKADTVIFRT-----DLYNTSAKRLEYKFKRTLKYDSKWLDK 252

Human   224 PHFVQALEHGDHVYFFFREVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCS 288
            |:||.:.:.|::|||||||.:||....|:..:||:|||||:|:||. ..|..:|.::||.|||||
  Fly   253 PNFVGSFDIGEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGK-NLLAHNWATYLKARLNCS 316

Human   289 VPGDSTFYFDVLQALTG-PVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRS 352
            :.|:..|||:.:|::.. |.:   :|..|..|||.||.:.|||||:|:::||:..|.||||||.|
  Fly   317 ISGEFPFYFNEIQSVYQLPSD---KSRFFATFTTSTNGLIGSAVCSFHINEIQAAFNGKFKEQSS 378

Human   353 LDGAWTPVSEDRVPSPRPGSCAGVGGAALFSSSRDLPDDVLTFIKAHPLLDPAV-----PPVTHQ 412
            .:.||.||...|||.||||:|.        :.:.:|||.||.||::|||:|.||     .||.::
  Fly   379 SNSAWLPVLNSRVPEPRPGTCV--------NDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYYK 435

Human   413 PLLTLTSRALLTQVAVDGMAGPHSNITVMFLGSNDGTVLKVLT--PGGRSGGPEPILLEEIDAYS 475
            ..|..| :.::.::.:|.:   :....|.::|:|.|.:.|::.  ..|.|      |.:.:|.:.
  Fly   436 RDLVFT-KLVVDKIRIDIL---NQEYIVYYVGTNLGRIYKIVQYYRNGES------LSKLLDIFE 490

Human   476 PARCSGKRTAQTARRIIGLELDTEGHRLFVAFSGCIVYLPLSRC-ARHGACQRSCLASQDPYCGW 539
            .|.....:..:.::....|.:.|: ||        |..:.|:.| .|:..|.| |:  :||||||
  Fly   491 VAPNEAIQVMEISQTRKSLYIGTD-HR--------IKQIDLAMCNRRYDNCFR-CV--RDPYCGW 543

Human   540  539
              Fly   544  543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEMA6CNP_001171532.1 Sema 53..517 CDD:301699 166/509 (33%)
PSI 518..570 CDD:279745 11/23 (48%)
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 165/500 (33%)
Ig_Semaphorin_C 573..664 CDD:143180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.