DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEBPA and Irbp18

DIOPT Version :9

Sequence 1:NP_001274353.1 Gene:CEBPA / 1050 HGNCID:1833 Length:393 Species:Homo sapiens
Sequence 2:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster


Alignment Length:85 Identity:26/85 - (30%)
Similarity:47/85 - (55%) Gaps:14/85 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   309 AKK----SVDKNSNE----------YRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRL 359
            |||    |..|||:.          |:.:|::||.||:::|:|.|:...|.::::.:|...||.|
  Fly     3 AKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDAL 67

Human   360 RKRVEQLSRELDTLRGIFRQ 379
            :.::|...:.:.|||.:..|
  Fly    68 KVQIETSEKHISTLRDLIIQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CEBPANP_001274353.1 bZIP_CEBPA 315..375 CDD:269859 20/69 (29%)
coiled coil 317..375 CDD:269859 18/67 (27%)
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 17/58 (29%)
coiled coil 25..83 CDD:269841 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41706
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.