DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK25 and stk24

DIOPT Version :9

Sequence 1:NP_001258906.1 Gene:STK25 / 10494 HGNCID:11404 Length:426 Species:Homo sapiens
Sequence 2:NP_001123697.1 Gene:stk24 / 100170450 XenbaseID:XB-GENE-987144 Length:424 Species:Xenopus tropicalis


Alignment Length:416 Identity:301/416 - (72%)
Similarity:344/416 - (82%) Gaps:19/416 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    10 QHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCD 74
            |..:.||||||.||::|||||||||:|||||.|::||||||||||||||||||||||||||||||
 Frog    14 QSLKADPEELFRKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCD 78

Human    75 SPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHR 139
            |||:|:|:|||||.|||||||||||||||||||:||||:||.||||||||||||||||||:||||
 Frog    79 SPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHR 143

Human   140 DIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGIT 204
            |||||||||||.|:||||||||||||||||||||||||||||||||||||||||.||||||||||
 Frog   144 DIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGIT 208

Human   205 AIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKF 269
            ||||||||||:|:||||:||||||||:||||||.:||..||||||||||:|.|||:|||||||||
 Frog   209 AIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKGLKEFVEACLNKEPSFRPSAKELLKHKF 273

Human   270 ITRYTKKTSFLTELIDRYKRWKSE-GHGEESS-SEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSK 332
            |.|..||||:||||||||||||.| ||...|| ||:.::|..|  |.:...|.|  |.|      
 Frog   274 IMRSAKKTSYLTELIDRYKRWKIEQGHEASSSDSEEEEVDQAA--GSEKDYWNF--TRR------ 328

Human   333 LHKGTALHSSQKPAEP-----VKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSL 392
              |....:....||:|     :.::|.||||||::.|:|.|||||.:..||:||::|||..|..|
 Frog   329 --KRDLKNLEPIPAQPEEVKDIPKRPLSQCLSTIMSPLFAELKEKSQACGGNVGSIEELREAIYL 391

Human   393 AEESCPGISDKLMVHLVERVQRFSHN 418
            |||:||||||.::..|:.|:||:|.|
 Frog   392 AEEACPGISDSMVSQLLIRLQRYSVN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK25NP_001258906.1 STKc_STK25 15..291 CDD:270810 242/275 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..355 20/70 (29%)
stk24NP_001123697.1 STKc_MST3 19..295 CDD:270809 242/275 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D152706at32523
OrthoFinder 1 1.000 - - FOG0000324
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X488
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.