| Sequence 1: | NP_006363.4 | Gene: | SYNCRIP / 10492 | HGNCID: | 16918 | Length: | 623 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_014382.1 | Gene: | PUB1 / 855716 | SGDID: | S000004961 | Length: | 453 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 255 | Identity: | 61/255 - (23%) |
|---|---|---|---|
| Similarity: | 100/255 - (39%) | Gaps: | 50/255 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Human 245 LFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSG 309
Human 310 KVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQFGKL--------ER 366
Human 367 VKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDY 431
Human 432 YYYG-------------------------PPH--------MPPPTRGRGRGGRGGYGYPP 458 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SYNCRIP | NP_006363.4 | NURR_hnRNPQ | 23..107 | CDD:410954 | |
| hnRNP-R-Q | 103..615 | CDD:273732 | 61/255 (24%) | ||
| Interaction with APOBEC1 | 400..561 | 16/92 (17%) | |||
| 8 X 3 AA repeats of R-G-G | 448..559 | 3/11 (27%) | |||
| 3 X 4 AA repeats of Y-Y-G-Y | 460..488 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 497..623 | ||||
| Interaction with SMN. /evidence=ECO:0000269|PubMed:11574476 | 518..549 | ||||
| Bipartite nuclear localization signal. /evidence=ECO:0000255 | 564..578 | ||||
| PUB1 | NP_014382.1 | RRM1_PUB1 | 77..150 | CDD:410026 | 21/77 (27%) |
| RRM2_PUB1 | 161..240 | CDD:410031 | 24/81 (30%) | ||
| RRM3_PUB1 | 341..414 | CDD:410033 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||