DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB13 and pb

DIOPT Version :10

Sequence 1:NP_006352.2 Gene:HOXB13 / 10481 HGNCID:5112 Length:284 Species:Homo sapiens
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:57 Identity:26/57 - (45%)
Similarity:42/57 - (73%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   217 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK 273
            |:.|..|:..||.|||:|:..||::.:.:|.:|:|:..|:|||:.:||||||:|.|:
  Fly   199 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB13NP_006352.2 HoxA13_N 12..123 CDD:463521
Homeodomain 217..273 CDD:459649 25/55 (45%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 217..246 11/28 (39%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 258..269 7/10 (70%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 270..273 1/2 (50%)
pbNP_476669.3 Homeodomain 199..255 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.