DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEACAM5 and rst

DIOPT Version :9

Sequence 1:NP_001278413.1 Gene:CEACAM5 / 1048 HGNCID:1817 Length:702 Species:Homo sapiens
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:730 Identity:145/730 - (19%)
Similarity:252/730 - (34%) Gaps:242/730 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   154 SKPVEDKDAVAFTCEPETQDA-----------------TYLWWVNNQSLPVSPRL---------- 191
            |.|........|..||:.|.|                 |..|..::..|..|..|          
  Fly    19 SSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVG 83

Human   192 QLSNGNRTLTLFNVTRNDTASYKCE-TQNPVS--ARRSDSVILNVLYGPDAPTISPLNTSYRSGE 253
            ....|:.:|.::.|..:|.|.|:|: :..|..  |.||....|.||..|:||.|:..:..|.:.:
  Fly    84 SDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATED 148

Human   254 -NLNLSC-HAASNPPAQYSWF--VNGTFQQSTQELFIP-------------NIT---VNNSGSYT 298
             .:.:.| .....|.|:.:|.  :......:.:...||             .:|   .:::.:::
  Fly   149 RKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFS 213

Human   299 CQAHNSDTGLNRTTVTTITV-YAEPPKPFITSNNSNP----------------------VEDEDA 340
            |||.|:.....|:....:.| ||  ||..:....|.|                      :.:...
  Fly   214 CQAQNTADRTYRSAKIRVEVKYA--PKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQ 276

Human   341 VALTCEPEI--QNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTR--NDVGPYECGIQNELSV 401
            |.|.|..:.  .:..|.|::|::.:       :......:.:.:|||  :| ...:|.:||  ||
  Fly   277 VRLECRADANPSDVRYRWFINDEPI-------IGGQKTEMVIRNVTRKFHD-AIVKCEVQN--SV 331

Human   402 DHS-DPVILNVLYGPDDPTISPSYTYYRP-------GVNLSLSCHAASNPPAQYSWLIDGNIQQH 458
            ..| |...|::.|       :||:. .||       |..:||:|...|||..:..|:      ||
  Fly   332 GKSEDSETLDISY-------APSFR-QRPQSMEADVGSVVSLTCEVDSNPQPEIVWI------QH 382

Human   459 TQELFIS-------NITEKNSGLYTCQANNSASGHSRTTVKTITVSAEL-----PKPSISSNNSK 511
            ..:..:.       :::.:.:|.|.|:||  ..|::.       :||:.     ..|:|.|..::
  Fly   383 PSDRVVGTSTNLTFSVSNETAGRYYCKAN--VPGYAE-------ISADAYVYLKGSPAIGSQRTQ 438

Human   512 PVEDKDAVAFTC----EPEAQNTTYLWWVNGQSL------PVSPRLQLSNGNRTLTLFNVTRNDA 566
            .....|.....|    .|.|::.:  |..|||.:      ..|..:....|....||  :.| |:
  Fly   439 YGLVGDTARIECFASSVPRARHVS--WTFNGQEISSESGHDYSILVDAVPGGVKSTL--IIR-DS 498

Human   567 RAYVCGIQN--------------SVSANRSDPVTLDVLYG------------------------- 592
            :||..|..|              .:.|.:|..:.:.::.|                         
  Fly   499 QAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTK 563

Human   593 -PDTPIIS---------------PPD--SSY------LSGANLNLSCHSAS-NPSPQY----SWR 628
             |...:||               |.|  |:|      :||..:....:|.. :|.|||    |.:
  Fly   564 LPPADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTTCSTK 628

Human   629 INGIP----------------------QQHTQ--VLFIAKITPNNNGTY-ACFVSNLATGRNNSI 668
            .||..                      |.|||  .|.:..:|.::.|:. ...:.:....::|.:
  Fly   629 SNGSSTIMQNNHQNQLQLQQQQQQSHHQHHTQTTTLPMTFLTNSSGGSLTGSIIGSREIRQDNGL 693

Human   669 --VKSITVSASGTSP 681
              ::|.|.|...:||
  Fly   694 PSLQSTTASVVSSSP 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CEACAM5NP_001278413.1 Ig_CEACAM_D1 36..140 CDD:143251
Ig_CEACAM_D4 146..234 CDD:143217 24/109 (22%)
IG_like 157..219 CDD:214653 17/89 (19%)
Ig_2 240..318 CDD:290606 15/97 (15%)
IG_like 244..318 CDD:214653 13/93 (14%)
Ig_CEACAM_D4 324..412 CDD:143217 21/114 (18%)
Ig_2 418..496 CDD:290606 20/91 (22%)
IG_like 422..496 CDD:214653 20/87 (23%)
Ig 502..590 CDD:299845 23/111 (21%)
IG_like 513..589 CDD:214653 20/99 (20%)
Ig_2 596..674 CDD:290606 25/132 (19%)
IG_like 600..659 CDD:214653 21/96 (22%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 21/95 (22%)
Ig 42..114 CDD:299845 12/71 (17%)
C2-set_2 135..225 CDD:285423 14/89 (16%)
Ig_3 265..329 CDD:290638 11/71 (15%)
I-set 346..420 CDD:254352 20/89 (22%)
Ig 360..425 CDD:299845 18/79 (23%)
Ig5_KIRREL3-like 428..524 CDD:143235 21/100 (21%)
IG_like 435..524 CDD:214653 18/93 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12288
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.