DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2E3 and Ubc2

DIOPT Version :9

Sequence 1:NP_001265483.1 Gene:UBE2E3 / 10477 HGNCID:12479 Length:207 Species:Homo sapiens
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:236 Identity:156/236 - (66%)
Similarity:170/236 - (72%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSDRQRSDDESPSTSSGSSDADQRDPAAPE-----------------PEEQEERKPSAT----- 43
            |||..........:|||.:|:|    |:||.                 |:.:..|..:|.     
  Fly     1 MSSTPAAGSAAEVATSSATSNA----PSAPSTTASNVSNTSQPTTAGTPQARGGRGSNANGGASG 61

Human    44 -------QQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPP 101
                   :.:|..|.:.:.:..|.|||||||||||||||||||||||||||||:|||.|||||||
  Fly    62 SNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPP 126

Human   102 GSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSI 166
            |||||||||||||.||.:|||||||||||||||||||||||||||||||||||||||||||||||
  Fly   127 GSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSI 191

Human   167 CSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT 207
            ||||||||||||||||||||||.||.|||||||.|||||||
  Fly   192 CSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYAT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2E3NP_001265483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 18/90 (20%)
UQ_con 65..202 CDD:395127 128/136 (94%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 136/144 (94%)
UQ_con 90..227 CDD:278603 128/136 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 271 1.000 Domainoid score I1821
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I2691
Isobase 1 0.950 - 0 Normalized mean entropy S139
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0002573
OrthoInspector 1 1.000 - - otm40329
orthoMCL 1 0.900 - - OOG6_103488
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4811
SonicParanoid 1 1.000 - - X1929
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.820

Return to query results.
Submit another query.