DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB18 and CG31365

DIOPT Version :9

Sequence 1:NP_991331.1 Gene:ZBTB18 / 10472 HGNCID:13030 Length:531 Species:Homo sapiens
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:479 Identity:113/479 - (23%)
Similarity:197/479 - (41%) Gaps:98/479 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    93 EGKLQFKD----LPIEDVL--------------AAASYLHMYDIVKVCKKKLKEKATTEADSTKK 139
            |.:|:|:|    :.::|.:              ..|:.:|. .:|| .:.:|:.|.|||......
  Fly   109 EDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHK-RLVK-SRLELRAKLTTELRKELA 171

Human   140 EEDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIP 204
            ||..|..  :.|...:..|.:..||.:  :..||.:      |..||...|.:.:.|....||..
  Fly   172 EEVRSEV--RKELAEEVRSQVRDDLRN--EVSEDIR------KEQLAMLLGELEVYLTEKKAGRW 226

Human   205 QAGGEAEPHATAAGKTVASPC-SSTESLSQRSVTSV----------RDSADVDCVLDLSVKSSLS 258
            ::...:||......|..|||. |.|::|.:|..:.|          :|:.:.:.:|..:...:.:
  Fly   227 ESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANN 291

Human   259 GVENLNSSYF-------SSQDVLRSNLV----------QVKVEKEASC-DESDVGTNDYDMEHST 305
            ...|::....       |.:|....|:|          ::.:...||. |::...|.::|.::..
  Fly   292 SDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGI 356

Human   306 VKESVSTNNRVQY---EPAHLAPLREDSVL----RELDREDKA--------------SDDEMMTP 349
            ...::..:..:|:   :|..:    ||.|:    .|:.:|.:.              :|.:..||
  Fly   357 TSYNIKEDGEIQFSGEKPEEI----EDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTP 417

Human   350 -----ESERVQVEGGMESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIR 409
                 .||.|..:   |||.....:..::...:.|.|.||...||:..:|..|.:||.:   |::
  Fly   418 LKRKRSSELVFKQ---ESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIK---GLK 476

Human   410 SKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKP 474
            |.....:..|:|:|   ..||..:||||...|:|.||:.|::|..||.....|.||...||..|.
  Fly   477 SGKGGTLKCPSCAL---QLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKR 538

Human   475 HACKWCERRFTQSGDLYRHIRKFH 498
            |.|..|...|.|..:|.:||.:.|
  Fly   539 HQCPQCSSCFAQKSNLQQHIGRVH 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB18NP_991331.1 BTB 23..119 CDD:279045 7/43 (16%)
BTB 34..119 CDD:197585 7/43 (16%)
COG5048 <303..>490 CDD:227381 56/212 (26%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 421..441 CDD:275368 8/19 (42%)
zf-H2C2_2 434..456 CDD:290200 10/21 (48%)
C2H2 Zn finger 449..469 CDD:275368 7/19 (37%)
C2H2 Zn finger 477..495 CDD:275368 6/17 (35%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 33/146 (23%)
RRF <161..222 CDD:294170 18/70 (26%)
zf-C2H2_8 454..530 CDD:292531 28/81 (35%)
C2H2 Zn finger 485..505 CDD:275368 9/22 (41%)
zf-H2C2_2 497..522 CDD:290200 12/24 (50%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.