DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDX4 and cad

DIOPT Version :9

Sequence 1:NP_005184.1 Gene:CDX4 / 1046 HGNCID:1808 Length:284 Species:Homo sapiens
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:253 Identity:92/253 - (36%)
Similarity:118/253 - (46%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    11 AGMYPG------TLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSL 69
            :|..||      |..|.|..|..|.||.||.....|.|   |.|....::. ..:||     |.:
  Fly   128 SGGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGS---APPNHQQHIA-EGLPS-----PPI 183

Human    70 GVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGG 134
            .|.||..|.|         .:.|..:.|.:.:....:|..:.:.:|       .:.::.|.....
  Fly   184 TVSGSEISSP---------GAPTSASSPHHHLAHHLSAVANNNNNN-------NNNNNSPSTHNN 232

Human   135 SLVPTDAGAAKASSPSRSRHSPY-AWMRK----------------------TVQVTGKTRTKEKY 176
            :...........:|||:   .|| .||:|                      .:..:||||||:||
  Fly   233 NNNNNSVSNNNRTSPSK---PPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKY 294

Human   177 RVVYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKK 234
            ||||||.||||||||:..:|||||:||||||..|.|||||||||||||||||||..||
  Fly   295 RVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDX4NP_005184.1 Caudal_act 13..162 CDD:309740 35/155 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40 11/30 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..155 4/34 (12%)
Homeobox 177..229 CDD:306543 42/51 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..259
cadNP_001260641.1 Homeobox 295..347 CDD:278475 42/51 (82%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7170
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm40805
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.