DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ECI2 and Acbp4

DIOPT Version :10

Sequence 1:NP_996667.2 Gene:ECI2 / 10455 HGNCID:14601 Length:394 Species:Homo sapiens
Sequence 2:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster


Alignment Length:78 Identity:32/78 - (41%)
Similarity:45/78 - (57%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    43 FENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAA 107
            ||.:....|...|.|.:...|:.|.|:||||.|..|:.|||:.||..||.::||||...|.|:||
  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68

Human   108 RQNYVDLVSSLSP 120
            ::.||.:....:|
  Fly    69 KEAYVKVYEKYAP 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ECI2NP_996667.2 ACBP 39..113 CDD:469667 30/69 (43%)
crotonase-like 142..335 CDD:119339
ECH-like 151..322
Microbody targeting signal. /evidence=ECO:0000255 392..394
Acbp4NP_648081.1 ACBP 4..84 CDD:469667 32/78 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.