DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ECI2 and anox

DIOPT Version :9

Sequence 1:	NP_996667.2	Gene:	ECI2 / 10455	HGNCID:	14601	Length:	394	Species:	Homo sapiens
Sequence 2:	NP_001027085.1	Gene:	anox / 3771728	FlyBaseID:	FBgn0064116	Length:	243	Species:	Drosophila melanogaster

Alignment Length:	114	Identity:	39/114 - (34%)
Similarity:	55/114 - (48%)	Gaps:	21/114 - (18%)

- Green bases have known domain annotations that are detailed below.

Human    58 GNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSL 122
            |:...|..|..|||||.|||....||:..|..|:||.||..||::.:.||||.||..:..|.|:.
  Fly    28 GSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQAYVQKLQELQPNW 92

Human   123 ESSSQVEPGTDRKSTGFETLVVTSEDGI---------TKIMFNRPKKKN 162
            .|         |::.|:   ||.|.:.:         .|.:|:..|:.|
  Fly    93 RS---------RRNPGW---VVHSIESVPLEDQRLDSEKTLFDHVKENN 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ECI2	NP_996667.2	ACBP	40..113	CDD:279259	26/54 (48%)
		Acyl-CoA binding. /evidence=ECO:0000250	66..70		1/3 (33%)
		crotonase-like	142..335	CDD:119339	7/30 (23%)
		ECH-like	151..322		4/12 (33%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:Q05871	198..202
		Microbody targeting signal. /evidence=ECO:0000255	392..394
anox	NP_001027085.1	ACBP	10..90	CDD:279259	28/61 (46%)
		ANK	125..231	CDD:238125	2/5 (40%)
		Ank_2	125..212	CDD:289560	2/5 (40%)
		ANK repeat	148..179	CDD:293786
		ANK repeat	181..212	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4281
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810