DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPIE and cyp33

DIOPT Version :9

Sequence 1:NP_001181936.1 Gene:PPIE / 10450 HGNCID:9258 Length:314 Species:Homo sapiens
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:281 Identity:187/281 - (66%)
Similarity:226/281 - (80%) Gaps:5/281 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAID 65
            |:..||.:||||||:||.:::|:.||||||||.|||:|.|||:::||||||:|:|.:||||||||
  Fly     1 MSNDKRTIYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAID 65

Human    66 NMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGE 130
            |||:|||.|||||||||||:|:||.|.:|:|:|||||:|.:|.||:...|.|..   |.||....
  Fly    66 NMNDSELCGRTIRVNLAKPVRVKEDSFKPIWADDDWLQKHAGATLQPEGEPEAE---KVETPSTG 127

Human   131 P--IAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRII 193
            |  |.|..:.||||:.||:||...||||.||||:||||.||||||.|||||:|:|:||.||||:|
  Fly   128 PAVIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVI 192

Human   194 PQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWL 258
            |:||||||||||:|||||||||||||:||||.|||...|.|||||||.||||||||:...|||||
  Fly   193 PEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWL 257

Human   259 DGKHVVFGEVTEGLDVLRQIE 279
            |.||||||.|..|.:|:|::|
  Fly   258 DNKHVVFGHVISGAEVVRKME 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPIENP_001181936.1 RRM <5..>84 CDD:223796 57/78 (73%)
RRM_PPIE 8..80 CDD:240793 51/71 (72%)
cyclophilin_ABH_like 140..279 CDD:238907 102/138 (74%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793 51/71 (72%)
cyclophilin_ABH_like 139..297 CDD:238907 103/140 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2341
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38142
Inparanoid 1 1.050 413 1.000 Inparanoid score I1859
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484092at2759
OrthoFinder 1 1.000 - - FOG0004615
OrthoInspector 1 1.000 - - oto91411
orthoMCL 1 0.900 - - OOG6_106441
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4943
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.