DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDIPT and CLS

DIOPT Version :9

Sequence 1:XP_005255095.1 Gene:CDIPT / 10423 HGNCID:1769 Length:237 Species:Homo sapiens
Sequence 2:NP_001262969.1 Gene:CLS / 43104 FlyBaseID:FBgn0039360 Length:322 Species:Drosophila melanogaster


Alignment Length:173 Identity:42/173 - (24%)
Similarity:61/173 - (35%) Gaps:55/173 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   103 LLVNLALLYP--GATLF---FQISMSL------------DVASHWLHLHSSVVRGSESHKMID-- 148
            |.::.|:|.|  |..:.   |.:.|||            .:|..|....|..  ||....|.|  
  Fly   132 LTISRAVLSPYIGYVIVQGDFTLGMSLLAFAGITDLLDGQIARRWPSQASKF--GSFLDPMADKL 194

Human   149 LSGNPVLRIYYTSRPAL-----------FTLCAGNELFYCLL-----YLFHFS--------EGPL 189
            |.|:.|:.:.||....:           |.|.||..:.|..|     :..:|.        |..|
  Fly   195 LMGSLVISLCYTDLLPMWLMGIVVFRDVFLLGAGFVIRYISLPPPKTFSRYFDATHVTAQLEPTL 259

Human   190 VGSVG----LFRMGLWVTAPI------ALLKSLISVIHLITAA 222
            :..:.    |..:||.:.|||      ..|:.|..:..|.|||
  Fly   260 LSKINTGVQLATIGLSLGAPIWNYLDHPALQGLWYLTGLTTAA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDIPTXP_005255095.1 CDP-OH_P_transf <85..223 CDD:294308 42/173 (24%)
CLSNP_001262969.1 PgsA 125..316 CDD:223632 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0558
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.