DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAP1 and hyd

DIOPT Version :9

Sequence 1:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens
Sequence 2:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster


Alignment Length:579 Identity:107/579 - (18%)
Similarity:178/579 - (30%) Gaps:208/579 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    30 PSGPGQPAPAATQAAPQAPPAGHQIVHVRG------DSETDLEALFNAVMNPKTANVPQTVPM-- 86
            |:.|..|...:.||:....||......|.|      :|..|......::|...|:.....:|:  
  Fly  1886 PNHPLHPLNLSAQASSSQTPAPATSSSVNGVNIMGSNSRRDFFTYCLSLMRSHTSEHRDALPVLD 1950

Human    87 --RLRKLP---DSF--FKPPEPKSHSRQASTDAGTAGALTP------------------------ 120
              .||.:.   |:|  :...:...:.:| .|.:|....|:|                        
  Fly  1951 ITALRHIAYVLDAFVYYMRNDSGFYDKQ-DTISGRINNLSPMTESYDTDDELANLEEFNADVQMS 2014

Human   121 --------QHVRAHS----SPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPL 173
                    |..|.|:    |.::|.||..:|                       ..||:|.|:.:
  Fly  2015 ASSMPSGSQGTRRHAFFARSESTLSLGCSAP-----------------------EGFELPLDMAM 2056

Human   174 PAGWE---MAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDG 235
            |...:   :...|..|..|.|.....||                        |..|  ||...||
  Fly  2057 PLADKPHLLQPNSKRQELFANLPLLVTT------------------------NANN--SGATNDG 2095

Human   236 WEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFGKAMNQRISQSAPVKQPPPLAPQSPQGGVM--- 297
                  ..|.|:         .:...||........|:|:.::.|:.     :.::..|.|.   
  Fly  2096 ------DGGSIF---------DYTPTRLGFSNSLKRNERVYETVPID-----SSKTGDGNVTNKA 2140

Human   298 -GGSNSNQQQQMRLQQ-------------LQMEKERLRL-----------KQQELLRQVRPQAM- 336
             |.::||...|::.:|             .|.:.|::.|           |..|.|...||:.: 
  Fly  2141 EGSTDSNIYVQLKKKQGSDDFKSHKEADGNQSKYEKVVLMETDDSLPSTSKSTEALMATRPEVII 2205

Human   337 ----RNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTY 397
                .:::|:|| :.....||..|.|.|::.|                   ..|.|...|::...
  Fly  2206 APNKASVSPATA-ARSVIVLAGGSCLKTIDSD-------------------INNYSASNLSTAEQ 2250

Human   398 HSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDL- 461
            ...|.......|......|.....|..|          |.|.|||.     ::|.:.....:|| 
  Fly  2251 AKCDTQYQKSTSDHLLLFPARGSQFYQS----------NFSELPSW-----NFLLSRWKLTLDLF 2300

Human   462 GTLEGDGMNIEGEELMPSLQ-------------EALSSDILNDMESVLAATKLDKESFL 507
            |.:..|.:.:|...::|.|:             |.|.:....|:  ||...:.::||.:
  Fly  2301 GRVFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDL--VLCKLERNRESLI 2357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YAP1XP_005271435.1 WW 174..203 CDD:238122 7/31 (23%)
WW 232..261 CDD:366073 4/28 (14%)
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033
HECTc 2589..2884 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.