DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAP1 and Herc4

DIOPT Version :9

Sequence 1:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:50 Identity:19/50 - (38%)
Similarity:24/50 - (48%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   117 ALTPQ--HVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSS 164
            ||.|.  .|.|....:|.|||..|..:|....||.||..:|:...|.||:
  Fly   321 ALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSPSGSALLQSN 370

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
YAP1XP_005271435.1 WW 174..203 CDD:238122
WW 232..261 CDD:366073
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826