DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAP1 and CG3356

DIOPT Version :9

Sequence 1:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:423 Identity:76/423 - (17%)
Similarity:119/423 - (28%) Gaps:175/423 - (41%)


- Green bases have known domain annotations that are detailed below.


Human   117 ALTPQHVRA---HSSPASLQLGAVSPGTLTPTGVV---SGPAAT--------------------- 154
            |.||:.:||   ..:..|.|||..:|.||...|||   .|...|                     
  Fly   496 AFTPKFIRAVWFKLAAESTQLGFSAPLTLISKGVVPKHQGVDRTIPLLATFCMLFGRLLPTLHDV 560

Human   155 ------------PTAQHLRQSSFEIPDDVPLPAGWEMAKT----SSG---------------QRY 188
                        .|..|:|...|.|.:.:      :|:||    |.|               .|.
  Fly   561 EFVENKLLLQVHSTINHVRLMPFSIAEII------QMSKTLKDISMGLVELAFPETRSNLANYRK 619

Human   189 FLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKN 253
            .|.|     |..|.:| :..|..:.|        |::|.....|    .|..|:|..:.:....:
  Fly   620 VLGH-----TEADDKK-LRHQKQIWA--------NLLNVVVFVL----NQIHTRDLRLGFCPEDH 666

Human   254 KTTSWLDPRLDPRFGKAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKE 318
                |...|||              .|:.:|..|.                              
  Fly   667 ----WTVTRLD--------------LPLDRPTDLP------------------------------ 683

Human   319 RLRLKQQELLRQVRP-QAMRNI-NPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELR 381
               |.....||.:|| |.:|:. .....|.|                          |..::::|
  Fly   684 ---LTHSSRLRGIRPFQPIRDFTREDFENGP--------------------------PMSTKQIR 719

Human   382 TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEM----------DTGDTIN 436
            ::|.....||:  ..::.|.....|.::.|...|......||.....:          |..|.:.
  Fly   720 SITILREIPFV--VPFNKRVSILQSLVAASKMRVQGNMQAFLQGPSVLITVRRSHLYEDAYDKLR 782

Human   437 QSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGM 469
            ....|..  ||...::.:....:|...::|.|:
  Fly   783 PDNEPDL--RFKFRIQFVSSLGLDEAGIDGGGV 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YAP1XP_005271435.1 WW 174..203 CDD:238122 10/47 (21%)
WW 232..261 CDD:366073 5/28 (18%)
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 8/50 (16%)
HECTc 788..1119 CDD:214523 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.