DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAP1 and yki

DIOPT Version :9

Sequence 1:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:313 Identity:97/313 - (30%)
Similarity:140/313 - (44%) Gaps:106/313 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    54 IVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQAST----DAGT 114
            :|.|..|::.:|:|||::|:||..|..|..:|:|:||||:|||.||.| ||||..|.    |||:
  Fly    57 VVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAP-SHSRANSADSTYDAGS 120

Human   115 AGAL----------------------------TPQ-------HVRAHSSPASLQLGAVSPGTLTP 144
            ..::                            :||       |.||.|||||||.. .:....:.
  Fly   121 QSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQN-YNVRARSD 184

Human   145 TGVVSGPAATPTAQ----------------------------------------------HLRQS 163
            ....:.|.|.|::|                                              |.:|.
  Fly   185 AAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQR 249

Human   164 SFEIPDDV-------PLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPR-----------KAMLSQM 210
            |:::...:       .||.|||.|||:.||.|:|||..::|.|:|||           ...:.|.
  Fly   250 SYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQN 314

Human   211 NVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRL 263
            :|...|.......:.|:. ||||||||||:|:.|::|:|||.::||||.|||:
  Fly   315 DVLQTTKQTTTSTIANNL-GPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YAP1XP_005271435.1 WW 174..203 CDD:238122 16/28 (57%)
WW 232..261 CDD:366073 18/28 (64%)
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 46/107 (43%)
WW 266..295 CDD:395320 16/28 (57%)
WW 335..364 CDD:395320 18/28 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159007
Domainoid 1 1.000 54 1.000 Domainoid score I11301
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1006566at2759
OrthoFinder 1 1.000 - - FOG0003509
OrthoInspector 1 1.000 - - otm40799
orthoMCL 1 0.900 - - OOG6_107951
Panther 1 1.100 - - LDO PTHR17616
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4834
SonicParanoid 1 1.000 - - X2881
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.